Made & Tested in the USA

IGF-1 LR3

IGF-1 LR3

Engineered 83-amino-acid IGF-1 analog with Arg3 substitution and N-terminal MFPAMPLSSLFVN extension more info
IGF-1 LR3 (Long-[Arg3]-Insulin-like Growth Factor 1) is an 83-amino-acid engineered analog of native human IGF-1, designed by Geoffrey Francis, F.J. Ballard, and colleagues at the CSIRO Division of Human Nutrition / GroPep in Adelaide, Australia in 1992 (PMID 1378742) as a cell-culture reagent for serum-free mammalian-bioreactor monoclonal-antibody production. The molecule carries a 13-amino-acid N-terminal extension (MFPAMPLSSLFVN) derived from a methionyl porcine growth hormone leader sequence and a Glu3-to-Arg3 substitution on the native IGF-1 chain. No registered human clinical trial of IGF-1 LR3 has been completed or published. The only FDA-approved IGF-1 drug, mecasermin (Tercica / Ipsen, NDA 021839, approved August 30, 2005), is the native 70-amino-acid IGF-1 sequence and a structurally distinct molecule.

Available for laboratory research use only.

Quality Standards

Vial size

Choose your supply

Most Popular

3 vials· 3mg total

$122.55/ vial

Save $19.35 (5% off)

Total

$367.65

Volume pricing applies to your total vials, not just this product. Mix or match any vials in your cart to reach the next tier.

Quantity

Independent Lab Results

The most comprehensive testing panel in research peptide commerce. Every batch is independently verified by ILS Laboratories — an ISO/IEC 17025 and PJLA-accredited facility in San Diego, CA.

  • Identity
  • Purity (HPLC)
  • Endotoxin (USP <85>)
  • Sterility (USP <71>)
  • Heavy metals (ICP-MS per USP <233>)

Biochemical Profile

CAS Number
946870-92-4
Molecular Formula
C400H625N111O115S9
Molecular Weight
~9117.6 g/mol
Purity
≥98% (RP-HPLC + SDS-PAGE (single ~10 kDa band, reducing and non-reducing))
PubChem CID
16133850
Amino Acid Sequence
MFPAMPLSSLFVN-GP-R-TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA (83 aa: residues 1-13 N-terminal extension, residue 16 Arg3 substitution; alternative CAS 143045-27-6 also circulates)

Receptor Targets and IGFBP-Evasion Engineering

IGF-1 LR3 has been investigated as an IGF-1 receptor (IGF-1R) agonist with sharply reduced affinity for the six insulin-like growth factor binding proteins (IGFBP-1 through IGFBP-6) that normally sequester native IGF-1 in circulation. The 13-amino-acid N-terminal extension (MFPAMPLSSLFVN) and the Glu3-to-Arg3 substitution are the two engineered modifications that produce the IGFBP-evasion phenotype. Both modifications were retained on a single recombinant chain because the IGF-1R contact surface lies elsewhere on the molecule and was deliberately spared in the original CSIRO Adelaide design[1].

The Arg3 substitution introduces a positive charge that disrupts contact with the N-terminal binding pocket of IGFBPs, most prominently IGFBP-1 and IGFBP-3. The 13-residue N-terminal extension further reduces IGFBP affinity by steric and charge masking of the IGFBP-contact surface. Together, the two modifications were reported to reduce IGFBP-binding affinity by >1000-fold relative to native IGF-1 in the foundational Francis 1992 paper and in subsequent vendor application data from R&D Systems / Bio-Techne and Repligen[1]. In cell-culture systems, this is the engineering rationale: in serum-free CHO media containing trace IGFBPs, native IGF-1 is rapidly sequestered and becomes biologically unavailable, while LR3 bypasses the sequestration system and remains free to engage IGF-1R at the cell surface.

NMR structural characterization by Laajoki et al. (1997) confirmed that the three alpha-helical regions of native IGF-1 are retained in the LR3 form and that the N-terminal extension adopts a relatively flexible, unstructured conformation rather than imposing additional secondary structure on the core IGF-1 fold[2]. The three intramolecular disulfide bridges of native IGF-1 (Cys6-Cys48, Cys47-Cys52, Cys18-Cys61 in native numbering) are conserved in the LR3 chain, and refolding of recombinant E. coli-derived material requires copper-catalyzed disulfide shuffling to reach the native disulfide isomer (Rosenfeld et al., 1997)[3].

Downstream signaling in published cell-culture work has been characterized as the canonical IGF-1R cascade: receptor autophosphorylation, recruitment of insulin-receptor substrate proteins (IRS-1/2), activation of the PI3K-Akt and MAPK pathways, and downstream effects on protein synthesis (mTORC1), anti-apoptosis (Akt), and proliferation. The molecule also weakly engages the insulin receptor (the receptors share architecture) at substantially lower affinity than the cognate IGF-1R interaction. In serum-free CHO media, LR3 reproducibly replaces insulin at approximately 100-fold lower molar concentrations in vendor application studies (Repligen application data; HEK293 serum-free culture report, PMID 17172665)[4].

The widely cited ~20-30 hour plasma half-life and ~3x potency advantage over native IGF-1 are derived from animal-model and in-vitro extrapolation, not from any published human pharmacokinetic study. No human PK data on IGF-1 LR3 have been published.

Research Applications

Cell-Culture Reagent Status and Clinical Status

IGF-1 LR3 was designed in 1992 as a cell-culture reagent for serum-free mammalian-bioreactor monoclonal-antibody production, and that use case remains its dominant legitimate commercial application[1]. The Francis 1992 paper from CSIRO Adelaide framed Long-[Arg3]-IGF-I as an attempt to escape the IGFBP system in serum-free cell-culture media where adventitious IGFBPs would otherwise sequester native IGF-1 and reduce bioactivity. GroPep, Novozymes Biopharma Sweden AB, and Repligen Corporation (which acquired the LONG R3 IGF-I business via the 2011 Novozymes acquisition) commercialized the molecule as a defined raw material for cGMP biologics manufacturing.

The only FDA-approved IGF-1 drug is mecasermin (NDA 021839, approved August 30, 2005)[5]. Mecasermin is the native 70-amino-acid IGF-1 sequence, not the 83-amino-acid LR3 analog. The two molecules differ by the 13-residue N-terminal extension and the Arg3 substitution, and the IGFBP-binding pharmacology differs by approximately three orders of magnitude. The mecasermin clinical label and safety profile cannot be extrapolated to LR3. A ClinicalTrials.gov search for 'IGF-1 LR3' or 'Long R3 IGF-1' returns no completed or active human interventional trials of the LR3 variant. Zero human Phase 1, Phase 2, or Phase 3 trials of LR3 have been published in the peer-reviewed literature.

The IGF-1 signaling axis is heavily implicated in human cancer biology. A published review of IGF-1 mechanisms in cancer (PMC4164051) documented PI3K-Akt and MAPK activation, spontaneous tumor formation in transgenic IGF-1-overexpressing mice, and epidemiologic association of elevated circulating IGF-1 with prostate, breast, colorectal, and lung cancer risk[6]. Mainstream oncology drug development pursued IGF-1R blockade in cancer contexts (figitumumab, ganitumab, dalotuzumab, all of which failed Phase 3 with the IGF-1R-blocking monoclonal antibody architecture)[7]. The pharmacology of LR3 is the opposite direction: sustained, IGFBP-unbuffered IGF-1R agonism with extended tissue exposure. No human clinical trial has powered for malignancy outcomes with IGF-1 LR3 administration, and none has been attempted. WADA lists all exogenous IGF-1 forms, including the LR3 analog, under S2.2 (Growth Factors and Growth Factor Modulators), banned at all times in and out of competition with no Therapeutic Use Exemption pathway.

Cell-Culture and Bioreactor Reagent Research

Cell-culture-supplement research is the deepest and most reproducible evidence base for IGF-1 LR3. The Francis 1992 paper specifically framed the design as a strategy to escape IGFBP sequestration in serum-free media, and that use case is documented across multiple Repligen, R&D Systems / Bio-Techne, Qkine, Cell Sciences, and GenScript application notes for serum-free CHO, HEK293, and iPSC media formulations[1].

In serum-free CHO-cell media for monoclonal-antibody production, LONG R3 IGF-I supplementation has been reported to produce approximately 2x IgG titer improvement over insulin alone and approximately 40% titer improvement over equivalent insulin supplementation, with effective concentrations in the nanogram-per-mL range compared with microgram-per-mL concentrations required for insulin in the same culture systems (Repligen application data). PMID 17172665 reported LONG R3 IGF-I as a more potent alternative to insulin in serum-free HEK293 culture[4]. Defined-media formulations for iPSC maintenance have incorporated LR3 IGF-1 in animal-component-free (AOF) and carrier-protein-free formats as part of the broader replacement-of-FBS movement in regenerative-medicine cell-culture. MCF-7 breast cancer cell-proliferation bioassay is the standard vendor potency assay for quality-control release of cGMP cell-culture-grade material.

This evidence base supports cell-culture-supplement performance and biopharmaceutical-process residual specifications. It does not translate to in-vivo human pharmacology. Cell-culture EC50 values from MCF-7 and CHO proliferation assays were generated in systems that have no IGFBP buffer, no first-pass metabolism, no tissue compartments, and no immune system. Importing titer-improvement figures into in-vivo human-relevant claims inverts the original engineering intent of the molecule.

Preclinical Animal-Model Anabolism Research

The Tomas / Ballard / Owens / Francis collaboration at CSIRO Adelaide produced the foundational in-vivo preclinical anabolism literature for IGF-1 LR3 in the 1990s. Tomas et al. (1993) reported that LR3 administration restored growth in streptozotocin-diabetic rats at approximately 2-3x the per-mass anabolic activity of native IGF-1, with selective sparing of certain insulin-like metabolic effects (PMID 7683875)[8]. Tomas et al. (1994) reported a separate study examining protein and energy metabolism effects in tumor-bearing rats (PMID 8053901)[9]. Hill et al. (1999) examined effects on protein metabolism in beef heifers in a veterinary animal-science context (PMID 10370861)[10].

Modern animal-physiology work has continued in fetal-sheep growth-restriction models from the Limesand / Jonker / Stremming / White groups at the University of Arizona and Oregon Health and Science University. Jonker et al. (2020) reported coronary vascular growth in IGF-1-administered fetal sheep (PMID 32573852)[11]. Stremming et al. (2022) reported organ-specific growth effects in fetal sheep (PMID 36091374)[12]. White et al. (2025), in a late-gestation growth-restriction model, reported that IGF-1 LR3 did not produce the expected growth promotion in growth-restricted fetuses (PMID 39679943)[13]. The fetal-sheep literature is the closest a research model has come to a controlled-physiology research context for LR3, and the results are mixed across studies.

Levolger et al. (2019) used LR3 IGF-1 as a comparator anabolic agent in a tumor-bearing-rodent cancer-cachexia model and reported that LR3 alone did not robustly attenuate cachexia (PMID 31285507)[14]. The animal-model anabolism literature establishes effects in specific preclinical preparations under controlled conditions. Cross-species extrapolation from rat or sheep anabolism to human muscle physiology has not been supported by published human data.

IGF-1R Signaling and Pathway Pharmacology Research

The IGF-1R cascade activated by IGF-1 LR3 in cell-culture and animal-model systems has been characterized as the canonical IGF-1 axis: receptor autophosphorylation on tyrosine residues in the receptor beta-subunit cytoplasmic domain, recruitment of insulin-receptor substrate proteins IRS-1 and IRS-2, activation of the PI3K-Akt pathway with downstream effects on mTORC1-mediated protein synthesis and anti-apoptotic Akt signaling, and parallel activation of the MAPK / ERK1/2 pathway. The pharmacology mirrors native IGF-1 in cells expressing IGF-1R because the receptor contact surface was deliberately spared in the LR3 engineering design[1].

The weak insulin-receptor cross-reactivity of LR3 is a documented feature of the IGF / insulin family, where the IGF-1R and the insulin receptor share architecture and partial signaling-domain homology. In CHO and HEK293 serum-free culture, LR3 replaces insulin at approximately 100-fold lower molar concentrations than required for insulin supplementation, consistent with the higher-affinity IGF-1R engagement[4]. White et al. (2023) reported attenuated glucose-stimulated insulin secretion during acute IGF-1 LR3 infusion in fetal sheep (PMID 37114757), demonstrating off-target endocrine effects on the pancreatic beta-cell axis that would require careful monitoring in any clinical translation[15].

No published human pharmacokinetic study has measured plasma concentrations, half-life, bioavailability, or tissue distribution of IGF-1 LR3 in human subjects. The widely circulated 20-30 hour plasma half-life figure is derived from animal-model and in-vitro extrapolation. The widely circulated 3x potency advantage over native IGF-1 is reproducible in serum-free cell-culture systems lacking IGFBP buffer; in-vivo potency in the presence of intact IGFBP biology has not been characterized in humans.

Recombinant Expression and Refolding Research

Recombinant E. coli expression has been the dominant route for IGF-1 LR3 production since the original 1992 CSIRO Adelaide work. The molecule is cloned, expressed (often as an inclusion-body product or as a fusion construct), refolded in vitro to establish the three native disulfide bridges, and purified by reversed-phase HPLC on C4 or C18 columns with water / acetonitrile / TFA mobile phases[1]. Endotoxin removal via Q-Sepharose or hydrophobic-interaction chromatography is critical for cell-culture-grade product release; vendor cGMP specifications include endotoxin <0.05 EU/ug, animal-component-free (AOF) certification, and bioassay potency by MCF-7 proliferation EC50.

Lu et al. (2023) reported a Pichia pastoris expression system for IGF-1 and LR3 IGF-1 fused with xylanase as an alternative to E. coli expression (PMID 37261455)[16]. The Pichia system offers eukaryotic post-translational machinery and altered refolding kinetics, but E. coli remains the standard production route across the commercial vendor pool.

Refolding is the dominant manufacturing failure mode for any recombinant IGF-1 family protein. Rosenfeld et al. (1997) characterized the putative folding pathway of insulin-like growth factor-I and documented that the native disulfide isomer (Type II / PI) competes with a misfolded isomer (Type I / PII) during in-vitro oxidative refolding[3]. Copper-catalyzed disulfide shuffling is the standard final refolding step. Vendor quality-control must distinguish the native disulfide isomer from misfolded contaminants by RP-HPLC retention time and circular-dichroism spectra; misfolded isomers do not engage IGF-1R correctly and represent inactive material in any downstream application. Research-chemical-vendor quality control rarely includes disulfide-isomer analysis at the level documented for cGMP cell-culture-grade material.

Adjacent Molecules and Editorial Disambiguation

IGF-1 LR3 sits within an IGF axis of related molecules where confident editorial disambiguation is required. Native human IGF-1 (the 70-amino-acid mature chain encoded by the IGF1 gene on chromosome 12q23.2, UniProt P05019) is the parent molecule. Mecasermin (NDA 021839, Tercica / Ipsen 2005) is recombinant native 70-aa IGF-1 and is the only FDA-approved IGF-1 therapy[5]. Mecasermin rinfabate is a complex of IGF-1 with IGFBP-3 that entered legacy clinical development but was largely abandoned. Des(1-3)-IGF-I is an alternative IGFBP-evasion truncation variant from older CSIRO Adelaide work; it has not been widely commercialized.

IGF-2 is a sister growth factor that binds the same IGF-1R but with different IGFBP affinity. Insulin shares architectural homology and the IGF-1 / insulin / relaxin family precursor structure. Growth hormone (GH) is the upstream regulator of hepatic IGF-1 production and is also a WADA S2-banned substance.

Upstream GH secretagogues and GHRH analogs sometimes marketed alongside IGF-1 LR3 in research-chemical catalogs include CJC-1295, ipamorelin, tesamorelin, and sermorelin. These molecules act upstream of endogenous IGF-1 production and do not contain LR3-specific pharmacology. MGF (mechano-growth factor) is a splice variant of the IGF1 gene that is sometimes marketed alongside LR3 and is mechanistically distinct.

Monoclonal antibodies developed for oncology to BLOCK the IGF-1 axis (figitumumab, ganitumab, dalotuzumab) all failed Phase 3 clinical development[7]. These programs illustrate that mainstream pharmacology pursued IGF-1R BLOCKADE in cancer contexts, opposite in direction from the sustained agonism profile of IGF-1 LR3. The contrast is part of why the tumor-promotion concern around IGFBP-evading IGF-1 analogs cannot be dismissed: clinical pharmacology in cancer biology has historically aimed at reducing IGF-1 signaling, not amplifying it.

Reconstitution & Storage

Recommended Diluent
Sterile 0.6% acetic acid in water (preferred for solubility) or sterile water
Storage (lyophilized)
-20°C, sealed, desiccant, 12-24 months
Storage (reconstituted)
2-8°C aqueous, 7-14 days (vendor-dependent); freeze-thaw cycling accelerates aggregation and disulfide scrambling
Shelf Life
12-24 months lyophilized at -20°C; 6-12 months at 4°C

Research References

  1. [1] Francis GL, Ross M, Ballard FJ, Milner SJ, Senn C, McNeil KA, Wallace JC, King R, Wells JR. Novel recombinant fusion protein analogues of insulin-like growth factor (IGF)-I indicate the relative importance of IGF-binding protein and receptor binding for enhanced biological potency. J Mol Endocrinol. 1992;8(3):213-223. PMID:1378742
  2. [2] Laajoki LG, Le Breton GC, Edmondson SF, et al. Secondary structure determination of 15N-labelled human Long-[Arg-3]-insulin-like growth factor 1 by multidimensional NMR spectroscopy. FEBS Lett. 1997;420(2-3):169-174. doi:10.1016/S0014-5793(97)01510-8
  3. [3] Rosenfeld RD, Miller JA, Narhi LO, et al. Putative folding pathway of insulin-like growth factor-I. Arch Biochem Biophys. 1997;343(2):154-160. PMID:9186491
  4. [4] Morris AE, Schmid J. Long-R3-IGF-I as a more potent alternative to insulin in serum-free culture of HEK293 cells. Mol Biotechnol. 2007;35(1):17-22. PMID:17172665
  5. [5] U.S. Food and Drug Administration. Mecasermin injection label. NDA 021839; approved August 30, 2005; revised 2025. Sponsor: Ipsen Biopharmaceuticals (originally Tercica Inc.).
  6. [6] Werner H, Bruchim I. The insulin-like growth factor-I receptor as an oncogene. Arch Physiol Biochem. 2009;115(2):58-71. (PMC4164051 review of mechanisms by which IGF-I may promote cancer.)
  7. [7] Yee D. Anti-insulin-like growth factor therapy in breast cancer. J Mol Endocrinol. 2018;61(1):T61-T68. Reviews the figitumumab / ganitumab / dalotuzumab IGF-1R-blockade clinical development record. PMID:29588427
  8. [8] Tomas FM, Knowles SE, Owens PC, Chandler CS, Francis GL, Ballard FJ. Insulin-like growth factor-I and more potent variants restore growth of diabetic rats without inducing all characteristic insulin effects. Biochem J. 1993;291(Pt 3):781-786. PMID:7683875
  9. [9] Tomas FM, Chandler CS, Coyle P, Bourgeois CS, Burgoyne JL, Rofe AM. Effects of insulin and insulin-like growth factors on protein and energy metabolism in tumour-bearing rats. Biochem J. 1994;301(Pt 3):769-775. PMID:8053901
  10. [10] Hill RA, Hunter RA, Lindsay DB, Owens PC. Action of long(R3)-insulin-like growth factor-1 on protein metabolism in beef heifers. Domest Anim Endocrinol. 1999;16(4):219-229. PMID:10370861
  11. [11] Jonker SS, Kamna D, LoTurco D, Kailey J, Brown LD. Coronary vascular growth matches IGF-1-stimulated cardiac growth in fetal sheep. FASEB J. 2020;34(8):10041-10055. PMID:32573852
  12. [12] Stremming J, Heard S, Chang EI, et al. Sheep recombinant IGF-1 promotes organ-specific growth in fetal sheep. Front Physiol. 2022;13:954948. PMID:36091374
  13. [13] White A, Stremming J, Brown LD, et al. IGF-1 LR3 does not promote growth in late-gestation growth-restricted fetal sheep. Am J Physiol Endocrinol Metab. 2025;328(2):E152-E163. PMID:39679943
  14. [14] Levolger S, van den Engel S, Ambagtsheer G, et al. Inhibition of activin-like kinase 4/5 attenuates cancer cachexia associated muscle wasting. Sci Rep. 2019;9(1):9826. PMID:31285507
  15. [15] White A, Louey S, Chang EI, et al. Attenuated glucose-stimulated insulin secretion during an acute IGF-1 LR3 infusion. J Dev Orig Health Dis. 2023;14(5):624-633. PMID:37114757
  16. [16] Lu Z, Wang J, Liang Y, et al. Recombinant expression of IGF-1 and LR3 IGF-1 fused with xylanase in Pichia pastoris. Appl Microbiol Biotechnol. 2023;107(13):4179-4191. PMID:37261455
  17. [17] World Anti-Doping Agency. The Prohibited List 2026. Section S2.2: Growth Factors and Growth Factor Modulators. wada-ama.org. All exogenous IGF-1 forms, including the LR3 analog, are banned at all times in and out of competition; no Therapeutic Use Exemption pathway.
  18. [18] Repligen Corporation. Press release: Repligen acquires Novozymes Biopharma Sweden AB (LONG R3 IGF-I cell-culture supplement business and Protein A affinity ligand business) for approximately 22.7 million USD plus milestones. BusinessWire, October 27, 2011.

Scientific Journal Author

F. John Ballard, PhD

CSIRO Division of Human Nutrition / GroPep, Adelaide, South Australia (originating IGF-1 analog program)

Landmark Publications

  • Francis GL, Ross M, Ballard FJ, Milner SJ, Senn C, McNeil KA, Wallace JC, King R, Wells JR. Novel recombinant fusion protein analogues of insulin-like growth factor (IGF)-I indicate the relative importance of IGF-binding protein and receptor binding for enhanced biological potency. J Mol Endocrinol. 1992;8(3):213-223. (PMID 1378742) - the foundational LR3 IGF-1 characterization paper
  • Tomas FM, Knowles SE, Owens PC, Chandler CS, Francis GL, Ballard FJ. Insulin-like growth factor-I and more potent variants restore growth of diabetic rats without inducing all characteristic insulin effects. Biochem J. 1993;291(Pt 3):781-786. (PMID 7683875)
  • Hill RA, Hunter RA, Lindsay DB, Owens PC. Action of long(R3)-insulin-like growth factor-1 on protein metabolism in beef heifers. Domest Anim Endocrinol. 1999;16(4):219-229. (PMID 10370861)

Dr. Ballard is independently cited here as a co-originating researcher of IGF-1 LR3 at the CSIRO Division of Human Nutrition / GroPep in Adelaide, South Australia. There is no affiliation or commercial relationship between Dr. Ballard, the CSIRO, GroPep, or any associated commercial entity (including Novozymes Biopharma Sweden AB or Repligen Corporation, which acquired the LONG R3 IGF-I business in 2011), and Peerless Peptides.

Frequently Asked Questions